MetaGO result for job id PF07864

User Input

>PF07864 (80 residues)
EGWLIDPNKHWSLRFHRDQKSWRSDLFVFMDKGRAMPDGSPALLKSRRHLPKRDAVEIWN
KLRADGWHRVEPQWGVGLDP

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2eocA	0.64	2.65	0.132	0.850	Download
2	2ra8A	0.63	2.11	0.058	0.800	Download
3	2eenA	0.62	2.86	0.130	0.863	Download
4	1vw1A	0.60	3.14	0.104	0.938	Download
5	5i3eA	0.59	3.15	0.080	0.825	Download
6	5jrlA	0.59	2.65	0.059	0.825	Download
7	2dc4A	0.59	2.55	0.056	0.838	Download
8	4dqyC	0.58	3.17	0.075	0.825	Download
9	1yemB	0.58	2.84	0.069	0.850	Download
10	2cr9A	0.56	3.07	0.123	0.825	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003950	0.01	NAD+ ADP-ribosyltransferase activity
GO:0003910	0.01	DNA ligase (ATP) activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:2000679	0.01	positive regulation of transcription regulatory region DNA binding
GO:1990166	0.01	protein localization to site of double-strand break
GO:1904357	0.01	negative regulation of telomere maintenance via telomere lengthening
GO:0070911	0.01	global genome nucleotide-excision repair
GO:0070212	0.01	protein poly-ADP-ribosylation
GO:0060391	0.01	positive regulation of SMAD protein import into nucleus
GO:0060236	0.01	regulation of mitotic spindle organization
GO:0051106	0.01	positive regulation of DNA ligation
GO:0051103	0.01	DNA ligation involved in DNA repair
GO:0045944	0.01	positive regulation of transcription from RNA polymerase II promoter

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0070062	0.01	extracellular exosome
GO:0005739	0.01	mitochondrion
GO:0005730	0.01	nucleolus
GO:0005667	0.01	transcription factor complex
GO:0005654	0.01	nucleoplasm
GO:0005635	0.01	nuclear envelope
GO:0000784	0.01	nuclear chromosome, telomeric region

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]