MetaGO result for job id PF02326

User Input

>PF02326 (164 residues)
MPQLDQFTYLTQFVWLCVFYMTFYVLLYNDGLPKISRIIKLRKRLVSQEKVGAEQSNDRV
EQDVVFKECFQASANYLYSSVSGASKWCKGMVQLANAHKLQRMNKDYVCSLGEISVSQVI
KKNALSTLSPSTYQTTSLASRQTTALNKIYVLRGQKRTLAKIKN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5aymA	0.58	3.10	0.044	0.744	Download
2	5lilA	0.58	3.74	0.067	0.799	Download
3	5hygA	0.55	3.49	0.040	0.762	Download
4	5gkoA2	0.55	4.46	0.068	0.823	Download
5	3wmeA1	0.55	4.12	0.054	0.805	Download
6	2yl4A	0.55	4.27	0.037	0.780	Download
7	3g61A	0.54	3.84	0.062	0.793	Download
8	5khnB	0.54	4.88	0.068	0.842	Download
9	5u1dA1	0.54	4.09	0.040	0.768	Download
10	5u1dB	0.54	3.82	0.063	0.793	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0043492	0.11	ATPase activity, coupled to movement of substances
GO:0016820	0.11	hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
GO:0015405	0.11	P-P-bond-hydrolysis-driven transmembrane transporter activity
GO:0050897	0.10	cobalt ion binding
GO:0035639	0.03	purine ribonucleoside triphosphate binding
GO:0032559	0.03	adenyl ribonucleotide binding
GO:0032550	0.03	purine ribonucleoside binding
GO:0046961	0.01	proton-transporting ATPase activity, rotational mechanism
GO:0046933	0.01	proton-transporting ATP synthase activity, rotational mechanism

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044763	0.28	single-organism cellular process
GO:0044765	0.10	single-organism transport
GO:1901564	0.07	organonitrogen compound metabolic process
GO:0044711	0.07	single-organism biosynthetic process
GO:0044249	0.07	cellular biosynthetic process
GO:0009117	0.07	nucleotide metabolic process
GO:1901576	0.06	organic substance biosynthetic process
GO:0061732	0.02	mitochondrial acetyl-CoA biosynthetic process from pyruvate
GO:0015986	0.02	ATP synthesis coupled proton transport
GO:0040007	0.01	growth

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005739	0.03	mitochondrion
GO:0016020	0.02	membrane
GO:0016021	0.01	integral component of membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]