MetaGO result for job id PF16976

User Input

>113228799/1-110 (110 residues)
MDGNHGSSMFSNSRFESRRIKIVRLDVGFDENCFCADAAYSENGRYIGIRRHDNLCAGTD
VQHHQRQDQSVQTACDTDAAFCANVIRKLLLESDYLLPQDVPAFGQDPRY

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3cs1A	0.50	4.19	0.087	0.836	Download
2	1irkA2	0.48	4.38	0.052	0.827	Download
3	4f0iB	0.48	4.37	0.052	0.827	Download
4	1rjbA	0.48	4.41	0.096	0.818	Download
5	1lufA2	0.47	4.31	0.094	0.818	Download
6	3v5qA2	0.47	4.53	0.083	0.818	Download
7	3ky2A2	0.47	4.27	0.060	0.800	Download
8	3zzwA2	0.47	4.63	0.071	0.836	Download
9	5k5xA	0.47	4.29	0.104	0.818	Download
10	3h10A	0.47	4.49	0.052	0.827	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0046872	0.05	metal ion binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0098779	0.01	mitophagy in response to mitochondrial depolarization
GO:0060316	0.01	positive regulation of ryanodine-sensitive calcium-release channel activity
GO:0055117	0.01	regulation of cardiac muscle contraction
GO:0051343	0.01	positive regulation of cyclic-nucleotide phosphodiesterase activity
GO:0032516	0.01	positive regulation of phosphoprotein phosphatase activity
GO:0032465	0.01	regulation of cytokinesis
GO:0030801	0.01	positive regulation of cyclic nucleotide metabolic process
GO:0021762	0.01	substantia nigra development
GO:0010880	0.01	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0005513	0.01	detection of calcium ion

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0070062	0.02	extracellular exosome
GO:0043005	0.01	neuron projection
GO:0034704	0.01	calcium channel complex
GO:0031514	0.01	motile cilium
GO:0030426	0.01	growth cone
GO:0030017	0.01	sarcomere
GO:0008076	0.01	voltage-gated potassium channel complex
GO:0005886	0.01	plasma membrane
GO:0005876	0.01	spindle microtubule
GO:0005856	0.01	cytoskeleton

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]