MetaGO result for job id PF16250

User Input

>UniRef100_A5ZII9/1-112 (112 residues)
MNGKKMTKKNSSRLFVAGILTAAICLAFSVAATSDTHYSIEIIEVNGGYGYQISHNNHIT
IFQPFIPAISGKKPFMEKEDAKKVGKLVMRRMKTGENYTVTRHDLENLGIKI

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3ecpA	0.53	3.86	0.036	0.777	Download
2	3w0lB	0.52	4.12	0.067	0.821	Download
3	2oaaB	0.51	3.83	0.058	0.795	Download
4	6f3tA	0.50	4.26	0.082	0.839	Download
5	4j05A	0.50	3.88	0.027	0.777	Download
6	4yooA2	0.50	4.48	0.029	0.911	Download
7	1n4mA	0.47	4.41	0.041	0.821	Download
8	2odiA	0.47	4.06	0.021	0.741	Download
9	4eljA3	0.45	4.17	0.023	0.768	Download
10	4ldsA2	0.42	4.29	0.031	0.688	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0070095	0.01	fructose-6-phosphate binding
GO:0030246	0.01	carbohydrate binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:2000679	0.01	positive regulation of transcription regulatory region DNA binding
GO:2000134	0.01	negative regulation of G1/S transition of mitotic cell cycle
GO:0097284	0.01	hepatocyte apoptotic process
GO:0090305	0.01	nucleic acid phosphodiester bond hydrolysis
GO:0090230	0.01	regulation of centromere complex assembly
GO:0071930	0.01	negative regulation of transcription involved in G1/S transition of mitotic cell cycle
GO:0071922	0.01	regulation of cohesin loading
GO:0071466	0.01	cellular response to xenobiotic stimulus
GO:0071459	0.01	protein localization to chromosome, centromeric region
GO:0070328	0.01	triglyceride homeostasis

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005654	0.02	nucleoplasm
GO:0035189	0.01	Rb-E2F complex
GO:0016605	0.01	PML body
GO:0016514	0.01	SWI/SNF complex
GO:0008024	0.01	cyclin/CDK positive transcription elongation factor complex
GO:0005819	0.01	spindle
GO:0000785	0.01	chromatin

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]