MetaGO result for job id PF16074

User Input

>k87_254609_1_1/28-157 (130 residues)
DAFLMRAIGHAYYIDEASNGVPSLYRESLDTGGSTTTAEEMVQGVENMQIQYGLDKDGDF
IPDRYVDADGVAADEWETDVVSARITLLLRSLTELASEPQAFSYLGTSYTPTDKHVRRVY
STTVKLRNRG

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5c4iA1	0.40	5.24	0.070	0.785	Download
2	6cinA	0.40	5.34	0.046	0.792	Download
3	1kekA1	0.40	5.31	0.045	0.792	Download
4	5hkjA	0.39	4.76	0.028	0.708	Download
5	4a01A	0.39	5.31	0.051	0.739	Download
6	3u7vA	0.39	5.42	0.056	0.754	Download
7	2epgB	0.39	5.05	0.043	0.739	Download
8	2jg8B	0.34	5.03	0.040	0.631	Download
9	1o91A	0.34	5.09	0.050	0.638	Download
10	4d7yA	0.33	5.36	0.099	0.661	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0042803	0.01	protein homodimerization activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0022607	0.09	cellular component assembly
GO:0043683	0.08	type IV pilus biogenesis
GO:0043107	0.08	type IV pilus-dependent motility
GO:2000590	0.01	negative regulation of metanephric mesenchymal cell migration
GO:2000584	0.01	negative regulation of platelet-derived growth factor receptor-alpha signaling pathway
GO:2000534	0.01	positive regulation of renal albumin absorption
GO:2000481	0.01	positive regulation of cAMP-dependent protein kinase activity
GO:2000478	0.01	positive regulation of metanephric glomerular visceral epithelial cell development
GO:2000467	0.01	positive regulation of glycogen (starch) synthase activity
GO:2000279	0.01	negative regulation of DNA biosynthetic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0070062	0.01	extracellular exosome
GO:0009986	0.01	cell surface
GO:0005581	0.01	collagen trimer
GO:0005576	0.01	extracellular region

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]