MetaGO result for job id PF13511

User Input

>71340173/1-106 (106 residues)
MKIAVIGTGYVGLVTGTCFAESGNEVTCIDKDARKIQTLEQGQLPIYEPGLEELVKRNRR
EERLRFTTDLPRGIAPAQLVFVAVGTPQSADGSADLSTVWAVSDAI

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5dgkA	0.49	3.92	0.030	0.802	Download
2	5glgA	0.47	4.38	0.096	0.849	Download
3	2culA	0.47	4.12	0.127	0.792	Download
4	2elcA	0.47	4.20	0.113	0.811	Download
5	3h5aA	0.47	4.44	0.118	0.821	Download
6	2y0cA1	0.47	4.23	0.310	0.792	Download
7	4urjA	0.47	4.00	0.054	0.792	Download
8	1jwbB	0.46	4.32	0.067	0.821	Download
9	3cmmC6	0.46	4.35	0.071	0.830	Download
10	2nvuA	0.46	4.28	0.097	0.802	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016616	0.36	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0003979	0.28	UDP-glucose 6-dehydrogenase activity
GO:0050660	0.01	flavin adenine dinucleotide binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0008152	0.30	metabolic process
GO:0006065	0.12	UDP-glucuronate biosynthetic process
GO:0005975	0.12	carbohydrate metabolic process
GO:0006024	0.03	glycosaminoglycan biosynthetic process
GO:0044710	0.02	single-organism metabolic process
GO:0090263	0.01	positive regulation of canonical Wnt signaling pathway
GO:0052546	0.01	cell wall pectin metabolic process
GO:0045880	0.01	positive regulation of smoothened signaling pathway
GO:0042121	0.01	alginic acid biosynthetic process
GO:0042048	0.01	olfactory behavior

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005829	0.20	cytosol
GO:0005634	0.03	nucleus

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]