MetaGO result for job id PF13430

User Input

>k87_15286728_1_1/21-129 (109 residues)
IEQEVQMLETLAHLMDSAFVIPGTSMRVGVDSLIGLIPGLGDTISALISRYIVKQASKYN
LPWHLKLKMSFNIFIDWLIGIIPLIGDLFDVGWKANTRNVELLKKHLEK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3vjzA	0.62	2.59	0.132	0.835	Download
2	6gy6A	0.61	3.70	0.065	0.936	Download
3	2o8fA	0.61	2.98	0.053	0.862	Download
4	6f0kC	0.61	3.56	0.047	0.917	Download
5	4bgoA	0.60	3.08	0.063	0.872	Download
6	1nneA3	0.60	2.79	0.078	0.826	Download
7	2hfiA	0.60	3.70	0.058	0.853	Download
8	5x9wA4	0.59	2.85	0.022	0.853	Download
9	5u70A1	0.59	2.92	0.089	0.826	Download
10	6qv5A	0.59	2.64	0.069	0.798	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term

Cscore^GO

Name

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0051096	0.01	positive regulation of helicase activity
GO:0045190	0.01	isotype switching
GO:0045128	0.01	negative regulation of reciprocal meiotic recombination
GO:0043570	0.01	maintenance of DNA repeat elements
GO:0043524	0.01	negative regulation of neuron apoptotic process
GO:0042771	0.01	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0031573	0.01	intra-S DNA damage checkpoint
GO:0030183	0.01	B cell differentiation
GO:0016446	0.01	somatic hypermutation of immunoglobulin genes
GO:0010224	0.01	response to UV-B

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0032302	0.01	MutSbeta complex
GO:0032301	0.01	MutSalpha complex
GO:0005654	0.01	nucleoplasm
GO:0000784	0.01	nuclear chromosome, telomeric region

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]