MetaGO result for job id PF12810

User Input

>k87_6125112_1_1/39-306 (268 residues)
SQTFSYTGAQQTFTVPSGVNSIQLKLWGAKGGYSYQSSHHGGYGGYATGTLSVSAGNTLY
IYVGGAGEDSHTCSNTSATANGGWNNGGTANRSGCGGGGGGGGSDVRINGTSLNDRIIVA
GGGGGAGYKYSNGNSQGGHGGGEEGGSGLSTIQRYGAPTGGTQSAGGNYASNSSLYFNGT
FGVGAESNGWSWGGAAGGGGWYGGGSGFHSGAGGSGYVYTSSSHKPSGYDPGSQYYLTDT
QLIGGDSTMPNPDGGTMTGRNGNGLIVI

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5gwnA	0.41	5.97	0.042	0.683	Download
2	5f30A	0.41	6.43	0.051	0.728	Download
3	5gsmA	0.41	6.75	0.029	0.757	Download
4	5d06A	0.41	6.16	0.025	0.683	Download
5	2wdaA	0.40	6.35	0.039	0.713	Download
6	1xdpA2	0.40	6.27	0.049	0.683	Download
7	1hmwA	0.40	6.64	0.028	0.739	Download
8	1xmeA	0.40	5.87	0.046	0.653	Download
9	1hn0A	0.38	6.35	0.065	0.668	Download
10	2q1fA	0.38	6.66	0.049	0.694	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901265	0.02	nucleoside phosphate binding
GO:0036094	0.02	small molecule binding
GO:0017056	0.01	structural constituent of nuclear pore
GO:0009982	0.01	pseudouridine synthase activity
GO:0008139	0.01	nuclear localization sequence binding
GO:0005487	0.01	nucleocytoplasmic transporter activity
GO:0004714	0.01	transmembrane receptor protein tyrosine kinase activity
GO:0004252	0.01	serine-type endopeptidase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.05	cellular process
GO:0044699	0.04	single-organism process
GO:0071704	0.03	organic substance metabolic process
GO:0044238	0.03	primary metabolic process
GO:0044237	0.03	cellular metabolic process
GO:0048856	0.02	anatomical structure development
GO:0044763	0.02	single-organism cellular process
GO:0044710	0.02	single-organism metabolic process
GO:0006464	0.02	cellular protein modification process
GO:0005975	0.02	carbohydrate metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005576	0.02	extracellular region
GO:0009358	0.01	polyphosphate kinase complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]