MetaGO result for job id PF11380

User Input

>UniRef100_UPI0007BAC5BF/8-113 (106 residues)
SASRFEDNEELRYSLRSIEKHAPWVRHIFIVTNGQIPSWLNLDNPRVSVVTHQDIFQNHS
HLPSFSSPAIETHIHRIPGLSQKFIYLNDDVMFGKDVWPDDFYSHS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3tsnA1	0.51	3.86	0.065	0.868	Download
2	2b7jB	0.51	4.75	0.049	0.915	Download
3	5ixcA	0.50	4.14	0.052	0.859	Download
4	1qztA	0.50	4.42	0.072	0.896	Download
5	2k6vA	0.48	4.50	0.063	0.859	Download
6	4e4rA1	0.47	4.56	0.063	0.868	Download
7	1vmiA1	0.47	4.17	0.044	0.802	Download
8	4bpyA	0.47	5.03	0.060	0.906	Download
9	1r5jA1	0.47	4.65	0.064	0.868	Download
10	1xcoD1	0.47	4.54	0.064	0.868	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.96	catalytic activity
GO:0016740	0.92	transferase activity
GO:0016772	0.65	transferase activity, transferring phosphorus-containing groups
GO:0003976	0.33	UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase activity
GO:0042802	0.01	identical protein binding
GO:0019899	0.01	enzyme binding
GO:0016788	0.01	hydrolase activity, acting on ester bonds
GO:0009055	0.01	electron carrier activity
GO:0008092	0.01	cytoskeletal protein binding
GO:0005102	0.01	receptor binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.94	single-organism process
GO:0009987	0.93	cellular process
GO:0008152	0.92	metabolic process
GO:0071704	0.90	organic substance metabolic process
GO:0044238	0.85	primary metabolic process
GO:0044237	0.70	cellular metabolic process
GO:0044710	0.67	single-organism metabolic process
GO:0044763	0.57	single-organism cellular process
GO:0006793	0.21	phosphorus metabolic process
GO:0005975	0.21	carbohydrate metabolic process
GO:0044723	0.20	single-organism carbohydrate metabolic process
GO:0006796	0.16	phosphate-containing compound metabolic process
GO:0065007	0.15	biological regulation
GO:0016310	0.13	phosphorylation
GO:0043170	0.11	macromolecule metabolic process
GO:0016043	0.09	cellular component organization

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	0.99	intracellular part
GO:0044444	0.96	cytoplasmic part
GO:0016020	0.76	membrane
GO:0043226	0.42	organelle
GO:0043229	0.34	intracellular organelle
GO:0044446	0.27	intracellular organelle part
GO:0043227	0.24	membrane-bounded organelle
GO:0031090	0.20	organelle membrane
GO:0043231	0.17	intracellular membrane-bounded organelle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]