MetaGO result for job id PF11141

User Input

>112916936/1-30 (30 residues)
RHFLSMEYVDGEDLASLLRRIWRLPPDKAV

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2pnkA1	0.57	2.71	0.067	1.000	Download
2	1iyeA1	0.56	2.61	0.067	0.967	Download
3	6g71A	0.55	1.93	0.138	0.967	Download
4	1omrA	0.55	2.37	0.034	0.933	Download
5	4r0mB1	0.55	2.31	0.103	0.867	Download
6	6nurA	0.55	2.69	0.034	0.967	Download
7	2b6pA	0.55	1.86	0.067	0.833	Download
8	1z98A	0.54	1.80	0.067	0.833	Download
9	3d9sA	0.54	1.86	0.033	0.833	Download
10	1h4bA	0.54	2.25	0.033	0.967	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016740	0.06	transferase activity
GO:0004672	0.03	protein kinase activity
GO:0016769	0.02	transferase activity, transferring nitrogenous groups
GO:0004674	0.02	protein serine/threonine kinase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0071704	0.03	organic substance metabolic process
GO:0044238	0.03	primary metabolic process
GO:0044237	0.03	cellular metabolic process
GO:0035556	0.02	intracellular signal transduction
GO:0018105	0.02	peptidyl-serine phosphorylation
GO:0071377	0.01	cellular response to glucagon stimulus
GO:0071322	0.01	cellular response to carbohydrate stimulus
GO:0071224	0.01	cellular response to peptidoglycan
GO:0055114	0.01	oxidation-reduction process
GO:0051447	0.01	negative regulation of meiotic cell cycle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0071013	0.01	catalytic step 2 spliceosome
GO:0005965	0.01	protein farnesyltransferase complex
GO:0005953	0.01	CAAX-protein geranylgeranyltransferase complex
GO:0005622	0.01	intracellular
GO:0000974	0.01	Prp19 complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]