MetaGO result for job id PF05128

User Input

>k87_12860637_1_1/1-222 (222 residues)
VIPASASPQSLPRPGQRPVQPPAEIGLLVRRLAAVLHADGEELLADNILLQCRDLGSAGR
DLLDRQRSQEARRIIDRYTWISAGVVAATPLPGVDLLGTAAVNAQMVMEMGAVYGIELTR
SRAQELAVSVGRTLAGLGVVKGGVALIGTALSVNLPTLLLGRAVQGVAAGWLTRIAGASF
MTYFQQDQDWGDGGVQDVVQHHYELNKRDRSLQDFLQAALRR

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1bxrA	0.44	5.88	0.059	0.757	Download
2	2f6dA	0.44	6.04	0.037	0.775	Download
3	3rkoN	0.43	5.62	0.093	0.716	Download
4	3vtaA	0.43	5.49	0.056	0.707	Download
5	4kcaA	0.43	5.91	0.051	0.761	Download
6	5xxzA	0.43	5.71	0.073	0.730	Download
7	3wkwA	0.43	5.22	0.068	0.689	Download
8	1urjB1	0.42	6.01	0.070	0.748	Download
9	1wmfA	0.42	5.74	0.065	0.730	Download
10	3afgA	0.41	5.52	0.070	0.694	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0035639	0.80	purine ribonucleoside triphosphate binding
GO:0032555	0.80	purine ribonucleotide binding
GO:0032550	0.80	purine ribonucleoside binding
GO:0005525	0.30	GTP binding
GO:0003924	0.29	GTPase activity
GO:0043169	0.03	cation binding
GO:0032559	0.03	adenyl ribonucleotide binding
GO:0016879	0.03	ligase activity, forming carbon-nitrogen bonds

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:2001295	0.01	malonyl-CoA biosynthetic process
GO:0097009	0.01	energy homeostasis
GO:0060421	0.01	positive regulation of heart growth
GO:0051289	0.01	protein homotetramerization
GO:0043086	0.01	negative regulation of catalytic activity
GO:0031999	0.01	negative regulation of fatty acid beta-oxidation
GO:0031667	0.01	response to nutrient levels
GO:0031325	0.01	positive regulation of cellular metabolic process
GO:0010906	0.01	regulation of glucose metabolic process
GO:0010884	0.01	positive regulation of lipid storage

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:1905202	0.02	methylcrotonoyl-CoA carboxylase complex
GO:0012505	0.01	endomembrane system
GO:0005829	0.01	cytosol
GO:0005741	0.01	mitochondrial outer membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]