MetaGO result for job id PF04357

User Input

>15252229/11-291 (281 residues)
AGETINDIYMVRDPILRSTTKGDLYIAMFLCDRTGQLNGRMWQASENVYKSLPKPGFVHI
KGRSELYQNNMQIVINTVTPIDAEKVTVEDFLAHTTNDIGQMFAELKTIVGGIKNASLKA
LTEAFLGDAELMANFCKAPGGMKMHHGYIGGLLEHTHTMLRVAQALLPLYPHLQSDLVLA
GIFLHDMGKTEELSYDMAFSYTDSGQLIGHISKTLVMIHKKADILRSEGIEVKPEVLDAL
GHIILSHHGQYDYGSPKLPATSEAFIVYYIDDLDAKMNQVN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1gqiA	0.43	6.20	0.033	0.726	Download
2	5gxdA	0.43	6.64	0.059	0.776	Download
3	1uwkA	0.43	6.38	0.050	0.751	Download
4	5a22A	0.42	5.79	0.053	0.698	Download
5	4he8L	0.42	6.07	0.086	0.698	Download
6	1x87A1	0.36	6.45	0.068	0.641	Download
7	1xi6A	0.35	6.02	0.080	0.577	Download
8	2cb1A	0.32	7.10	0.076	0.612	Download
9	1l8nA2	0.31	6.77	0.047	0.569	Download
10	3lp8A	0.31	7.08	0.056	0.577	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0044682	0.13	archaeal-specific GTP cyclohydrolase activity
GO:0046559	0.01	alpha-glucuronidase activity
GO:0033939	0.01	xylan alpha-1,2-glucuronosidase activity
GO:0016153	0.01	urocanate hydratase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0034641	0.17	cellular nitrogen compound metabolic process
GO:0071704	0.15	organic substance metabolic process
GO:0044238	0.15	primary metabolic process
GO:0006725	0.15	cellular aromatic compound metabolic process
GO:0044260	0.14	cellular macromolecule metabolic process
GO:0031125	0.13	rRNA 3'-end processing
GO:2000886	0.01	glucuronoxylan catabolic process
GO:0032259	0.01	methylation
GO:0019557	0.01	histidine catabolic process to glutamate and formate
GO:0019556	0.01	histidine catabolic process to glutamate and formamide

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005730	0.03	nucleolus
GO:0005576	0.01	extracellular region

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]