MetaGO result for job id PF04066

User Input

>UniRef100_A0A1E2V677/6-87 (82 residues)
VPVAMGIFCVALLLNLWRLLIGPTLPDRILALDTMYINCIALIILYGIWQGSNLYFEAAL
LIAMLGFISTVAVCKYLLRGDI

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2r02A1	0.80	2.07	0.049	0.988	Download
2	3r9mA1	0.80	2.09	0.061	0.988	Download
3	5cwqA1	0.80	1.59	0.123	0.963	Download
4	5cwmA1	0.79	2.03	0.160	0.988	Download
5	3rauA	0.78	2.09	0.076	0.951	Download
6	1zb1A	0.78	2.02	0.087	0.951	Download
7	5cwnA2	0.71	2.25	0.114	0.951	Download
8	2ah6B	0.67	2.31	0.078	0.939	Download
9	5cwlA2	0.58	2.97	0.100	0.842	Download
10	5cwjA2	0.56	2.60	0.079	0.768	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0048306	0.01	calcium-dependent protein binding
GO:0042803	0.01	protein homodimerization activity
GO:0031871	0.01	proteinase activated receptor binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:1903553	0.01	positive regulation of extracellular exosome assembly
GO:1903543	0.01	positive regulation of exosomal secretion
GO:1901673	0.01	regulation of mitotic spindle assembly
GO:0090611	0.01	ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway
GO:0039702	0.01	viral budding via host ESCRT complex
GO:0036258	0.01	multivesicular body assembly
GO:0015031	0.01	protein transport
GO:0010824	0.01	regulation of centrosome duplication
GO:0007080	0.01	mitotic metaphase plate congression
GO:0006997	0.01	nucleus organization

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0070062	0.02	extracellular exosome
GO:1990707	0.01	nuclear subtelomeric heterochromatin
GO:0070971	0.01	endoplasmic reticulum exit site
GO:0043209	0.01	myelin sheath
GO:0042470	0.01	melanosome
GO:0036064	0.01	ciliary basal body
GO:0034990	0.01	nuclear mitotic cohesin complex
GO:0031934	0.01	mating-type region heterochromatin
GO:0031618	0.01	nuclear pericentric heterochromatin
GO:0031205	0.01	endoplasmic reticulum Sec complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]